A3740
ARHGDIB Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3740
- Zusätzliche Namen:
- ARHGDIB|D4|GDIA2|GDID4|Ly-GDI|LYGDI|RAP1GN1|RhoGDI2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 23 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
- Uniprot:
- P52566
- Synonyme:
- D4;GDIA2;GDID4;Ly-GDI;LYGDI;RAP1GN1;Rho GDI 2;Rho GDP dissociation inhibitor (GDI) beta;rho GDP-dissociation inhibitor 2;rho-GDI beta;RhoGDI2
- Weitere Details:
- Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).
- Versandbedingungen:
- Blue Ice