ALDH1B1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3725
Zusätzliche Namen:: ALDH1B1|ALDH5|ALDHX
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Uniprot:: P30837
Synonyme:: acetaldehyde dehydrogenase 5;aldehyde dehydrogenase 5;Aldehyde dehydrogenase family 1 member B1;aldehyde dehydrogenase X, mitochondrial;ALDH class 2;ALDH5;ALDHX;epididymis secretory sperm binding protein
Weitere Details:: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.