KMT1B / SUV39H2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3705
Zusätzliche Namen:: KMT1B|KMT1B / SUV39H2
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Uniprot:: Q9H5I1
Synonyme:: H3-K9-HMTase 2;histone H3-K9 methyltransferase 2;histone methyltransferase SUV39H2;histone-lysine N-methyltransferase SUV39H2;KMT1B;lysine N-methyltransferase 1B;su(var)3-9 homolog 2;suppressor of variegation 3-9 homolog 2
Weitere Details:: Enables S-adenosyl-L-methionine binding activity; histone methyltransferase activity (H3-K9 specific); and zinc ion binding activity. Involved in chromatin assembly or disassembly and chromatin remodeling. Acts upstream of or within cellular response to hypoxia and negative regulation of transcription by RNA polymerase II. Located in chromatin.