[KO Validated] HIF1AN/FIH1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3701
Zusätzliche Namen:: FIH1|H1
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKF
Uniprot:: Q9NWT6
Synonyme:: factor inhibiting HIF-1;factor inhibiting HIF1;FIH-1;FIH1;hypoxia inducible factor 1 alpha subunit inhibitor;hypoxia-inducible factor 1-alpha inhibitor;hypoxia-inducible factor asparagine hydroxylase;peptide-aspartate beta-dioxygenase
Weitere Details:: Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.