Plexin A1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3698
Zusätzliche Namen:: DWOPNED|NOV|NOVP|Plexin A1|PLEXIN-A1|PLXN1
Anwendung:: ELISA, WB
Molekulargewicht:: 250kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPT
Uniprot:: Q9UIW2
Synonyme:: NOV;NOVP;plexin 1;plexin-A1;PLXN1;semaphorin receptor NOV
Weitere Details:: Predicted to enable semaphorin receptor activity. Predicted to be involved in several processes, including generation of neurons; regulation of GTPase activity; and regulation of cell shape. Predicted to act upstream of or within dichotomous subdivision of terminal units involved in salivary gland branching; neuron projection morphogenesis; and regulation of smooth muscle cell migration. Located in cytosol and nucleoplasm.