Histone H2A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3692
Zusätzliche Namen:: H2A.1|H2A.2|H2A/a|H2AC4|H2AFA|HIST1H2AE|Histone H2A
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 14 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR
Uniprot:: P04908, P0C0S8
Synonyme:: dJ193B12.1;dJ193B12.9;H2A histone family, member A;H2A histone family, member C;H2A histone family, member D;H2A histone family, member I;H2A histone family, member M;H2A histone family, member N;H2A histone family, member P;H2A.1;H2A.1b;H2A.2;H2A.i;H2A/a;H2A/c;H2A/d;H2A/i;H2A/m;H2A/n;H2A/p;H2AC11;H2AC13;H2AC14;H2AC15;H2AC16;H2AC17;H2AC4;H2AC8;H2AFA;H2AFC;H2AFD;H2AFI;H2AFM;H2AFN;H2AFP;H2AG;HIST1H2AB;HIST1H2AE;HIST1H2AG;HIST1H2AI;HIST1H2AK;HIST1H2AL;HIST1H2AM;histone 1, H2ab;histone 1, H2ae;histone 1, H2ag;histone 1, H2ai;histone 1, H2ak;histone 1, H2al;histone 1, H2am;histone cluster 1 H2A family member b;histone cluster 1 H2A family member e;histone cluster 1 H2A family member g;histone cluster 1 H2A family member i;histone cluster 1 H2A family member k;histone cluster 1 H2A family member l;histone cluster 1 H2A family member m;histone cluster 1, H2ab;histone cluster 1, H2ae;histone cluster 1, H2ag;histone cluster 1, H2ai;histone cluster 1, H2ak;histone cluster 1, H2al;histone cluster 1, H2am;histone H2A type 1;histone H2A type 1-B/E;histone H2A type 1-J;Histone H2A.2;histone H2A/a;histone H2A/m;histone H2A/p;histone H2A/ptl;histone H2AE;pH2A/f
Weitere Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Versandbedingungen:: Blue Ice