MYH14 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A3690
Zusätzliche Namen:: DFNA4|DFNA4A|FP17425|MHC16|MYH14|MYH17|myosin|NMHC II-C|NMHC-II-C|PNMHH
Anwendung:: ELISA, WB
Molekulargewicht:: 252kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH
Uniprot:: Q7Z406
Synonyme:: DFNA4;DFNA4A;FP17425;MHC16;MYH14 variant protein;MYH17;myosin;Myosin heavy chain 14;myosin heavy chain, non-muscle IIc;myosin-14;myosin, heavy chain 14, non-muscle;myosin, heavy polypeptide 14;NMHC II-C;NMHC-II-C;non-muscle myosin heavy chain IIc;nonmuscle myosin heavy chain II-C;PNMHH
Weitere Details:: This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-14 (MYO14). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene result in one form of autosomal dominant hearing impairment. Multiple transcript variants encoding different isoforms have been found for this gene.