U1A/SNRPA Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3686
Zusätzliche Namen:: Mud1|U1-A|U1A|U1A/SNRPA
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 31kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT
Uniprot:: P09012
Synonyme:: Mud1;U1 small nuclear ribonucleoprotein A;U1 small nuclear RNP-specific A;U1 snRNP A;U1 snRNP-specific protein A;U1-A;U1A
Weitere Details:: The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.