A3671
PFKM Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3671
- Zusätzliche Namen:
- ATP-PFK|GSD7|PFK-1|PFK-A|PFK1|PFKA|PFKM|PFKX|PPP1R122
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 85 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEA
- Uniprot:
- P08237
- Synonyme:
- 6-phosphofructo-1-kinase;6-phosphofructokinase type A;6-phosphofructokinase, muscle type;ATP-dependent 6-phosphofructokinase, muscle type;ATP-PFK;GSD7;PFK-1;PFK-A;PFK1;PFKA;PFKX;phosphofructo-1-kinase isozyme A;phosphofructokinase 1;phosphofructokinase-M;phosphofructokinase, polypeptide X;phosphohexokinase;PPP1R122;protein phosphatase 1, regulatory subunit 122
- Weitere Details:
- Three phosphofructokinase isozymes exist in humans: muscle, liver and platelet. These isozymes function as subunits of the mammalian tetramer phosphofructokinase, which catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-bisphosphate. Tetramer composition varies depending on tissue type. This gene encodes the muscle-type isozyme. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease. Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice




