PSMD4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3663
Zusätzliche Namen:: AF|AF-1|ASF|MCB1|PSMD4|pUB-R5|Rpn10|S5A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE
Uniprot:: P55036
Synonyme:: 26S proteasome non-ATPase regulatory subunit 4;26S proteasome regulatory subunit RPN10;26S proteasome regulatory subunit S5A;AF;AF-1;angiocidin;antisecretory factor 1;ASF;MCB1;multiubiquitin chain-binding protein;proteasome (prosome, macropain) 26S subunit, non-ATPase, 4;proteasome 26S subunit, non-ATPase 4;pUB-R5;Rpn10;S5A;S5a/antisecretory factor protein
Weitere Details:: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.

Versandbedingungen:: Blue Ice