ELOVL4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3639
Zusätzliche Namen:: ADMD|CT118|ELOVL4|ISQMR|SCA34|STGD2|STGD3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMG
Uniprot:: Q9GZR5
Synonyme:: 3-keto acyl-CoA synthase ELOVL4;ADMD;cancer/testis antigen 118;CT118;elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4;elongation of very long chain fatty acids protein 4;ELOVL FA elongase 4;ELOVL fatty acid elongase 4;ISQMR;SCA34;STGD2;STGD3;very long chain 3-ketoacyl-CoA synthase 4;very long chain 3-oxoacyl-CoA synthase 4
Weitere Details:: This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration.