A3636
SLC16A2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3636
- Zusätzliche Namen:
- AHDS|DXS128|DXS128E|MCT 7|MCT 8|MCT7|MCT8|MRX22|SLC16A2|XPCT
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG
- Uniprot:
- P36021
- Synonyme:
- AHDS;DXS128;DXS128E;MCT 7;MCT 8;MCT7;MCT8;monocarboxylate transporter 7;monocarboxylate transporter 8;MRX22;Solute carrier family 16 member 2;solute carrier family 16, member 2 (thyroid hormone transporter);X-linked PEST-containing transporter;XPCT
- Weitere Details:
- This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome.
- Versandbedingungen:
- Blue Ice

