CLEC11A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3634
Zusätzliche Namen:: CLEC11A|CLECSF3|LSLCL|P47|SCGF
Anwendung:: ELISA, WB
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Uniprot:: Q9Y240
Synonyme:: C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3;C-type lectin domain family 11 member A;C-type lectin superfamily member 3;CLECSF3;LSLCL;lymphocyte secreted C-type lectin;lymphocyte secreted long form of C-type lectin;osteolectin;P47;SCGF;stem cell growth factor;stem cell growth factor; lymphocyte secreted C-type lectin
Weitere Details:: This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined.