PKD2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3625
Zusätzliche Namen:: APKD2|Pc-2|PC2|PKD2|PKD4|TRPP2
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV
Uniprot:: Q13563
Synonyme:: APKD2;autosomal dominant polycystic kidney disease type II protein;Pc-2;PC2;PKD4;polycystic kidney disease 2 (autosomal dominant);Polycystic kidney disease 2 protein;polycystin-2;Polycystwin;R48321;transient receptor potential cation channel subfamily P member 2;TRPP2
Weitere Details:: This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.