Dynein intermediate chain 1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3624
Zusätzliche Namen:: CILD1|DIC1|Dynein intermediate chain 1|ICS1|PCD
Anwendung:: ELISA, WB
Molekulargewicht:: 79kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQ
Uniprot:: Q9UI46
Synonyme:: Axonemal dynein intermediate chain 1;CILD1;DIC1;dynein axonemal intermediate chain 1;dynein, axonemal, intermediate polypeptide 1;ICS1;immotile cilia syndrome 1;PCD;testis tissue sperm-binding protein Li 87P
Weitere Details:: This gene encodes a member of the dynein intermediate chain family. The encoded protein is part of the dynein complex in respiratory cilia. The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia and Kartagener syndrome. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice