A3613
MXD1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3613
- Zusätzliche Namen:
- BHLHC58|MAD|MAD1|MXD1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEG
- Uniprot:
- Q05195
- Synonyme:
- antagonizer of myc transcriptional activity;BHLHC58;MAD;MAD1;max dimerization protein 1;max dimerizer 1;MAX-binding protein;Protein MAD
- Weitere Details:
- This gene encodes a member of the MYC/MAX/MAD network of basic helix-loop-helix leucine zipper transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target genes by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice

