[KD Validated] SIRT6 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3591
Zusätzliche Namen:: hSIRT6|SIR2L6|SIRT6
Anwendung:: ELISA, WB
Molekulargewicht:: 42 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS
Uniprot:: Q8N6T7
Synonyme:: NAD-dependent protein deacetylase sirtuin-6;regulatory protein SIR2 homolog 6;SIR2-like protein 6;sir2-related protein type 6;SIR2L6;sirtuin type 6
Weitere Details:: This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms.