[KD Validated] STAT2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3588
Zusätzliche Namen:: [KD Validated] STAT2|IMD44|ISGF-3|P113|PTORCH3|STAT113
Anwendung:: ELISA, WB
Molekulargewicht:: 97kDa/113kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
Uniprot:: P52630
Synonyme:: IMD44;interferon alpha induced transcriptional activator;ISGF-3;P113;PTORCH3;signal transducer and activator of transcription 2;signal transducer and activator of transcription 2, 113kDa;STAT113
Weitere Details:: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44.

Versandbedingungen:: Blue Ice