A3581
DCR2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3581
- Zusätzliche Namen:
- CD264|DCR2|TRAIL-R4|TRAILR4|TRUNDD
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
- Uniprot:
- Q9UBN6
- Synonyme:
- CD264;DCR2;decoy receptor 2;TNF receptor-related receptor for TRAIL;TNF-related apoptosis-inducing ligand receptor 4;TRAIL receptor 4;TRAIL receptor with a truncated death domain;TRAIL-R4;TRAILR4;TRUNDD;tumor necrosis factor receptor superfamily member 10D;tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
- Weitere Details:
- The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.
- Versandbedingungen:
- Blue Ice








