A3577
[KO Validated] NRF2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3577
- Zusätzliche Namen:
- F2|HEBP1|IMDDHH|Nrf-2|NRF2
- Anwendung:
- ChIP, ELISA, WB, IP
- Molekulargewicht:
- 103kDa/97-100 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
- Uniprot:
- Q16236
- Synonyme:
- HEBP1;IMDDHH;Nrf-2;NRF2;nuclear factor erythroid 2-related factor 2;nuclear factor erythroid-derived 2-like 2;Nuclear factor, erythroid derived 2, like 2
- Weitere Details:
- This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene.
- Versandbedingungen:
- Blue Ice
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_1.jpg)
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_2.jpg)
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_3.jpg)
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_ARC0806(250623)_WB_01.jpg)
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_ARC0806_KO-WB_01.jpg)
![[KO Validated] NRF2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A3577/A3577_ARC0806_ChIP_01.jpg)