[KO Validated] NRF2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3577
Zusätzliche Namen:: F2|HEBP1|IMDDHH|Nrf-2|NRF2
Anwendung:: ChIP, ELISA, WB, IP
Molekulargewicht:: 103kDa/97-100 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
Uniprot:: Q16236
Synonyme:: HEBP1;IMDDHH;Nrf-2;NRF2;nuclear factor erythroid 2-related factor 2;nuclear factor erythroid-derived 2-like 2;Nuclear factor, erythroid derived 2, like 2
Weitere Details:: This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene.