SHIP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3571
Zusätzliche Namen:: hp51CN|p150Ship|SHIP|SHIP-1|SHIP1|SIP-145
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 145kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEG
Uniprot:: Q92835
Synonyme:: hp51CN;Inositol polyphosphate-5-phosphatase of 145 kDa;inositol polyphosphate-5-phosphatase, 145kD;inositol polyphosphate-5-phosphatase, 145kDa;p150Ship;phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1;phosphatidylinositol 4,5-bisphosphate 5-phosphatase;SH2 domain-containing inositol 5'-phosphatase 1;SHIP;SHIP-1;SHIP1;signaling inositol polyphosphate 5 phosphatase SIP-145;signaling inositol polyphosphate phosphatase SHIP II;SIP-145
Weitere Details:: This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system. Deficiencies in the encoded protein, SHIP1, have been associated with Inflammatory Bowel Disease types such as Crohn's Disease and Ulcerative Colitis. Alternative splicing of this gene results in multiple transcript variants.

Versandbedingungen:: Blue Ice