MEIS2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3566
Zusätzliche Namen:: CPCMR|HsT18361|MEIS2|MRG1
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELAT
Uniprot:: O14770
Synonyme:: CPCMR;homeobox protein Meis2;HsT18361;Meis homolog 2;Meis1-related gene 1;meis1-related protein 1;Meis1, myeloid ecotropic viral integration site 1 homolog 2;MRG1;TALE homeobox protein Meis2
Weitere Details:: This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.