NEK6 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3536
Zusätzliche Namen:: NEK6|SID6-1512
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
Uniprot:: Q9HC98
Synonyme:: never in mitosis A-related kinase 6;NIMA (never in mitosis gene a)-related kinase 6;nimA-related protein kinase 6;protein kinase SID6-1512;putative serine-threonine protein kinase;serine/threonine-protein kinase Nek6;SID6-1512
Weitere Details:: The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene.