A3524
IL13RA1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3524
- Zusätzliche Namen:
- CD213A1|CT19|IL-13Ra|IL13RA1|NR4
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGS
- Uniprot:
- P78552
- Synonyme:
- cancer/testis antigen 19;CD213A1;CD213a1 antigen;CT19;IL-13 receptor subunit alpha-1;IL-13R subunit alpha-1;IL-13Ra;IL13 receptor alpha-1 chain;interleukin 13 receptor, alpha 1;interleukin-13 receptor subunit alpha-1;NR4
- Weitere Details:
- The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
- Versandbedingungen:
- Blue Ice