A3523
TRIB3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3523
- Zusätzliche Namen:
- C20orf97|NIPK|SINK|SKIP3|TRB3|TRIB3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG
- Uniprot:
- Q96RU7
- Synonyme:
- C20orf97;neuronal cell death inducible putative kinase;Neuronal cell death-inducible putative kinase;NIPK;p65-interacting inhibitor of NF-kappa-B;p65-interacting inhibitor of NF-kappaB;SINK;SKIP3;TRB-3;TRB3;tribbles homolog 3
- Weitere Details:
- The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.
- Versandbedingungen:
- Blue Ice