THAP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3518
Zusätzliche Namen:: THAP2
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI
Uniprot:: Q9H0W7
Synonyme:: THAP domain containing, apoptosis associated protein 2;THAP domain-containing protein 2
Weitere Details:: Predicted to enable DNA binding activity and metal ion binding activity. Located in nucleolus.