Chromogranin B Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3517
Zusätzliche Namen:: Chromogranin B|SCG1
Anwendung:: ELISA, WB
Molekulargewicht:: 110 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTE
Uniprot:: P05060
Synonyme:: cgB;Chromogranin-B;SCG1;secretogranin B;secretogranin I;secretogranin-1;sgI
Weitere Details:: This gene encodes a tyrosine-sulfated secretory protein abundant in peptidergic endocrine cells and neurons. This protein may serve as a precursor for regulatory peptides.