A3496
EHD1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3496
- Zusätzliche Namen:
- EHD1|H-PAST|HPAST1|PAST|PAST1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 61kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAV
- Uniprot:
- Q9H4M9
- Synonyme:
- EH domain-containing protein 1;H-PAST;HPAST1;PAST;PAST homolog 1;PAST1;testilin
- Weitere Details:
- This gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The protein encoded by this gene is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice