A3479
VIPAS39 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3479
- Zusätzliche Namen:
- C14orf133|hSPE-39|SPE-39|SPE39|VIPAR|VIPAS39|VPS16B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVR
- Uniprot:
- Q9H9C1
- Synonyme:
- C14orf133;hSPE-39;SPE-39;SPE39;spermatogenesis-defective protein 39 homolog;VIPAR;VPS16B;VPS33B-interacting protein in apical-basolateral polarity regulator;VPS33B-interacting protein in polarity and apical restriction;VPS33B-interacting protein involved in polarity and apical protein restriction
- Weitere Details:
- Involved in endosome to lysosome transport and intracellular protein transport. Acts upstream of or within collagen metabolic process and peptidyl-lysine hydroxylation. Located in Golgi apparatus and endosome. Implicated in arthrogryposis, renal dysfunction, and cholestasis 2.
- Versandbedingungen:
- Blue Ice