A3461
S100A6 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3461
- Zusätzliche Namen:
- 2A9|5B10|CABP|CACY|PRA|S100A6|S10A6
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 10kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
- Uniprot:
- P06703
- Synonyme:
- 2A9;5B10;CABP;CACY;calcyclin;growth factor-inducible protein 2A9;MLN 4;PRA;prolactin receptor-associated protein;protein S100-A6;S100 calcium-binding protein A6;S10A6
- Weitere Details:
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.
- Versandbedingungen:
- Blue Ice








