[KO Validated] TBK1/NAK Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3458
Zusätzliche Namen:: FTDALS4|IIAE8|NAK|T2K|TBK1/NAK
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 84kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE
Uniprot:: Q9UHD2
Synonyme:: FTDALS4;IIAE8;NAK;NF-kappa-B-activating kinase;NF-kB-activating kinase;serine/threonine-protein kinase TBK1;T2K;TANK-binding kinase 1
Weitere Details:: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. The protein is also an important kinase for antiviral innate immunity response.