PON1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3441
Zusätzliche Namen:: ESA|MVCD5|PON|PON1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEE
Uniprot:: P27169
Synonyme:: A-esterase 1;aromatic esterase 1;arylesterase 1;arylesterase B-type;ESA;esterase A;K-45;MVCD5;paraoxonase B-type;PON;PON 1;serum aryldiakylphosphatase;serum aryldialkylphosphatase 1;serum paraoxonase/arylesterase 1
Weitere Details:: This gene encodes a member of the paraoxonase family of enzymes and exhibits lactonase and ester hydrolase activity. Following synthesis in the kidney and liver, the enzyme is secreted into the circulation, where it binds to high density lipoprotein (HDL) particles and hydrolyzes thiolactones and xenobiotics, including paraoxon, a metabolite of the insecticide parathion. Polymorphisms in this gene may be associated with coronary artery disease and diabetic retinopathy. The gene is found in a cluster of three related paraoxonase genes on chromosome 7.