A3437
PAF1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3437
- Zusätzliche Namen:
- F23149_1|PAF1|PD2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLINPDTYRIDPNVLL
- Uniprot:
- Q8N7H5
- Synonyme:
- F23149_1;Paf1, RNA polymerase II associated factor, homolog;pancreatic differentiation protein 2;PD2;RNA polymerase II-associated factor 1 homolog
- Weitere Details:
- This gene encodes a subunit of the polymerase associated factor (PAF1) complex. The PAF1 complex interacts with RNA polymerase II and plays a role in transcription elongation as well as histone modifications including ubiquitylation and methylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice