A3436
C14orf166 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3436
- Zusätzliche Namen:
- C14orf166|CGI-99|CGI99|CLE|CLE7|hCLE|hCLE1|LCRP369|RLLM1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25kDa/28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
- Uniprot:
- Q9Y224
- Synonyme:
- C14orf166;CGI-99;CGI99;CLE;CLE7;CLE7 homolog;hCLE;hCLE1;LCRP369;RLL motif containing 1;RLLM1;RNA transcription, translation and transport factor protein;UPF0568 protein C14orf166
- Weitere Details:
- Enables RNA binding activity; RNA polymerase II complex binding activity; and identical protein binding activity. Involved in negative regulation of protein kinase activity; positive regulation of transcription by RNA polymerase II; and tRNA splicing, via endonucleolytic cleavage and ligation. Located in microtubule cytoskeleton; nucleoplasm; and perinuclear region of cytoplasm. Part of tRNA-splicing ligase complex.
- Versandbedingungen:
- Blue Ice



