RRM2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3424
Zusätzliche Namen:: C2orf48|R2|RR2|RR2M|RRM2
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE
Uniprot:: P31350
Synonyme:: C2orf48;R2;ribonucleoside-diphosphate reductase subunit M2;ribonucleotide reductase M2 polypeptide;ribonucleotide reductase small chain;ribonucleotide reductase small subunit;RR2;RR2M;uncharacterized protein C2orf48
Weitere Details:: This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.