A3395
Menin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3395
- Zusätzliche Namen:
- MEAI|Menin|SCG2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 72kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL
- Uniprot:
- O00255
- Synonyme:
- MEAI;menin;SCG2
- Weitere Details:
- This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones.
- Versandbedingungen:
- Blue Ice