KAT8/MYST1/MOF Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3390
Zusätzliche Namen:: hMOF|KAT8/MYST1/MOF|LIGOWS|MOF|MYST1|ZC2HC8
Anwendung:: ELISA, IHC-P, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
Uniprot:: Q9H7Z6
Synonyme:: histone acetyltransferase KAT8;histone acetyltransferase MYST1;hMOF;K(lysine) acetyltransferase 8;LIGOWS;Lysine acetyltransferase 8;MOF;MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1;MYST histone acetyltransferase 1;MYST-1;MYST1;ortholog of Drosophila males absent on the first (MOF);probable histone acetyltransferase MYST1;ZC2HC8
Weitere Details:: This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene.