ADAMTS13 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3370
Zusätzliche Namen:: ADAM-TS13|ADAMTS-13|ADAMTS13|C9orf8|vWF-CP|VWFCP
Anwendung:: ELISA, WB, IF
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSPGAPLKGRPPSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSS
Uniprot:: Q76LX8
Synonyme:: A disintegrin and metalloproteinase with thrombospondin motifs 13;a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13;ADAM-TS13;ADAMTS-13;C9orf8;von Willebrand factor-cleaving protease;vWF-cleaving protease;vWF-CP;VWFCP
Weitere Details:: This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants.