A3312
NDUFC2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3312
- Zusätzliche Namen:
- B14.5b|CI-B14.5b|HLC-1|MC1DN36|NADHDH2|NDUFC2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF
- Uniprot:
- O95298
- Synonyme:
- B14.5b;CI-B14.5b;complex I subunit B14.5b;complex I-B14.5b;HLC-1;human lung cancer oncogene 1 protein;MC1DN36;NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa;NADH dehydrogenase [ubiquinone] 1 subunit C2;NADH-ubiquinone oxidoreductase subunit B14.5b;NADHDH2
- Weitere Details:
- Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.
- Versandbedingungen:
- Blue Ice

