A3306
TAB1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3306
- Zusätzliche Namen:
- 3'-Tab1|MAP3K7IP1|TAB1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP
- Uniprot:
- Q15750
- Synonyme:
- 3'-Tab1;MAP3K7IP1;mitogen-activated protein kinase kinase kinase 7-interacting protein 1;TAK1-binding protein 1;TGF-beta-activated kinase 1 and MAP3K7-binding protein 1;TGF-beta-activated kinase 1-binding protein 1;transforming growth factor beta-activated kinase-binding protein 1
- Weitere Details:
- The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice



