CXCR2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3301
Zusätzliche Namen:: CD182|CDw128b|CMKAR2|CXCR2|IL8R2|IL8RA|IL8RB|WHIMS2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 46 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTT
Uniprot:: P25025
Synonyme:: C-X-C chemokine receptor type 2;CD182;CDw128b;chemokine (CXC) receptor 2;CMKAR2;CXC-R2;CXCR-2;CXCR2 gene for IL8 receptor type B;GRO/MGSA receptor;high affinity interleukin-8 receptor B;IL-8 receptor type 2;IL-8R B;IL8R2;IL8RA;IL8RB;interleukin 8 receptor type 2;interleukin 8 receptor, beta;interleukin-8 receptor type B;WHIMS2
Weitere Details:: The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified.

Versandbedingungen:: Blue Ice