A3290
COX8A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3290
- Zusätzliche Namen:
- COX|COX8|COX8-2|COX8A|COX8L|MC4DN15|VIII|VIII-L
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 8kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE
- Uniprot:
- P10176
- Synonyme:
- COX;COX8;COX8-2;COX8L;cytochrome c oxidase polypeptide VIII-liver/heart;cytochrome c oxidase subunit 8-2;cytochrome c oxidase subunit 8A (ubiquitous);cytochrome c oxidase subunit 8A, mitochondrial;cytochrome c oxidase subunit VIII;cytochrome c oxidase subunit VIIIA (ubiquitous);MC4DN15;VIII;VIII-L
- Weitere Details:
- The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits.
- Versandbedingungen:
- Blue Ice