CNGA3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3288
Zusätzliche Namen:: ACHM2|CCNC1|CCNCa|CCNCalpha|CNCG3|CNG3|CNGA3
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
Uniprot:: Q16281
Synonyme:: ACHM2;CCNC1;CCNCa;CCNCalpha;CNCG3;CNG channel alpha-3;CNG-3;CNG3;cone photoreceptor cGMP-gated channel alpha subunit;cone photoreceptor cGMP-gated channel subunit alpha;cyclic nucleotide gated channel alpha 3;cyclic nucleotide-gated cation channel alpha-3;Cyclic nucleotide-gated channel alpha-3
Weitere Details:: This gene encodes a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in this gene are associated with achromatopsia (rod monochromacy) and color blindness. Two alternatively spliced transcripts encoding different isoforms have been described.