HE4/WFDC2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3276
Zusätzliche Namen:: dJ461P17.6|EDDM4|HE4|HE4/WFDC2|WAP5
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Uniprot:: Q14508
Synonyme:: dJ461P17.6;EDDM4;epididymal protein 4;epididymal secretory protein E4;epididymis secretory sperm binding protein;epididymis-specific, whey-acidic protein type, four-disulfide core;HE4;human epididymis protein 4;major epididymis-specific protein E4;putative protease inhibitor WAP5;WAP domain containing protein HE4-V4;WAP four-disulfide core domain protein 2;WAP5
Weitere Details:: This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.