A3237
Twist Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3237
- Zusätzliche Namen:
- ACS3|bHLHa38|BPES2|BPES3|CRS|CRS1|CSO|SCS|SWCOS|TWIST
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP
- Uniprot:
- Q15672
- Synonyme:
- ACS3;B-HLH DNA binding protein;bHLHa38;BPES2;BPES3;class A basic helix-loop-helix protein 38;CRS;CRS1;CSO;H-twist;SCS;SWCOS;TWIST;twist basic helix-loop-helix transcription factor 1;twist homolog 1;TWIST homolog of drosophila;twist-related protein 1
- Weitere Details:
- This gene encodes a basic helix-loop-helix (bHLH) transcription factor that plays an important role in embryonic development. The encoded protein forms both homodimers and heterodimers that bind to DNA E box sequences and regulate the transcription of genes involved in cranial suture closure during skull development. This protein may also regulate neural tube closure, limb development and brown fat metabolism. This gene is hypermethylated and overexpressed in multiple human cancers, and the encoded protein promotes tumor cell invasion and metastasis, as well as metastatic recurrence. Mutations in this gene cause Saethre-Chotzen syndrome in human patients, which is characterized by craniosynostosis, ptosis and hypertelorism.
- Versandbedingungen:
- Blue Ice







