A3208
PPIF Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3208
- Zusätzliche Namen:
- Cyp-D|CyP-M|CYP3|CypD|PPIF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
- Uniprot:
- P30405
- Synonyme:
- cyclophilin 3;cyclophilin D;cyclophilin F;Cyp-D;CyP-M;CYP3;CypD;mitochondrial cyclophilin;peptidyl-prolyl cis-trans isomerase F, mitochondrial;peptidyl-prolyl cis-trans isomerase, mitochondrial;PPIase F;rotamase F
- Weitere Details:
- The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
- Versandbedingungen:
- Blue Ice

