A3196
NDUFA9 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3196
- Zusätzliche Namen:
- CC6|CI-39k|CI39k|COQ11|MC1DN26|NDUFA9|NDUFS2L|SDR22E1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSR
- Uniprot:
- Q16795
- Synonyme:
- CC6;CI-39k;CI-39kD;CI39k;complex I 39kDa subunit;Complex I-39kD;COQ11;MC1DN26;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa;NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial;NADH-ubiquinone oxidoreductase 39 kDa subunit;NDUFS2L;SDR22E1;short chain dehydrogenase/reductase family 22E, member 1
- Weitere Details:
- The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12.
- Versandbedingungen:
- Blue Ice