NPY Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3178
Zusätzliche Namen:: NPY|PYY4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 11kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Uniprot:: P01303
Synonyme:: prepro-neuropeptide Y;pro-neuropeptide Y;PYY4
Weitere Details:: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.