A3109
Alpha Internexin Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3109
- Zusätzliche Namen:
- Alpha Internexin|NEF5|NF-66|NF66|TXBP-1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
- Uniprot:
- Q16352
- Synonyme:
- 66 kDa neurofilament protein;alpha-internexin;alpha-Inx;NEF5;Neurofilament 5;neurofilament 5 (66kD);neurofilament-66, tax-binding protein;NF-66;NF66;TXBP-1
- Weitere Details:
- Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
- Versandbedingungen:
- Blue Ice