A3107
NFATC2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3107
- Zusätzliche Namen:
- JCOSL|NFAT1|NFATC2|NFATP
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
- Uniprot:
- Q13469
- Synonyme:
- NF-ATc2;NFAT pre-existing subunit;NFAT transcription complex, preexisting component;NFAT1;NFATP;nuclear factor of activated T-cells, cytoplasmic 2;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2;nuclear factor of activated T-cells, preexisting component;preexisting nuclear factor of activated T-cells 2;T cell transcription factor NFAT1;T-cell transcription factor NFAT1
- Weitere Details:
- This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants encoding different isoforms have been characterized.
- Versandbedingungen:
- Blue Ice